C6orf71 MaxPab mouse polyclonal antibody (B01) View larger

C6orf71 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C6orf71 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about C6orf71 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00389434-B01
Product name: C6orf71 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human C6orf71 protein.
Gene id: 389434
Gene name: IYD
Gene alias: C6orf71|DEHAL1|dJ422F24.1
Gene description: iodotyrosine deiodinase
Genbank accession: NM_203395
Immunogen: C6orf71 (NP_981932, 1 a.a. ~ 289 a.a) full-length human protein.
Immunogen sequence/protein sequence: MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTV
Protein accession: NP_981932
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00389434-B01-13-15-1.jpg
Application image note: Western Blot analysis of IYD expression in transfected 293T cell line (H00389434-T01) by IYD MaxPab polyclonal antibody.

Lane 1: C6orf71 transfected lysate(31.79 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C6orf71 MaxPab mouse polyclonal antibody (B01) now

Add to cart