> >>ANXA2R purified MaxPab mouse polyclonal antibody (B01P)
ANXA2R purified MaxPab mouse polyclonal antibody (B01P) View larger

ANXA2R purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of ANXA2R purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ANXA2R purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00389289-B01P
Product name: ANXA2R purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ANXA2R protein.
Gene id: 389289
Gene name: ANXA2R
Gene alias: AX2R|AXIIR|C5orf39
Gene description: annexin A2 receptor
Genbank accession: NM_001014279.1
Immunogen: ANXA2R (NP_001014301.1, 1 a.a. ~ 193 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDSCDLGLLSSPCWRLPGVYWQNGLSPGVQSTLEPSTAKPTEFSWPGTQKQQEAPVEEVGQAEEPDRLRLQQLPWSSPLHPWDRQQDTEVCDSGCLLERRHPPALQPWRHLPGFSDCLEWILRVGFAAFSVLWACCSRICGAKQP
Protein accession: NP_001014301.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00389289-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ANXA2R expression in transfected 293T cell line (H00389289-T01) by ANXA2R MaxPab polyclonal antibody.

Lane 1: ANXA2R transfected lysate(21.23 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ANXA2R purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart