CCDC4 MaxPab mouse polyclonal antibody (B01) View larger

CCDC4 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCDC4 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CCDC4 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00389206-B01
Product name: CCDC4 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CCDC4 protein.
Gene id: 389206
Gene name: BEND4
Gene alias: CCDC4|FLJ35632|FLJ43965|MGC157807|MGC157808
Gene description: BEN domain containing 4
Genbank accession: BC146593
Immunogen: CCDC4 (AAI46594.1, 1 a.a. ~ 416 a.a) full-length human protein.
Immunogen sequence/protein sequence: MQGAPRARFGSRTPPAAAASSSSPSCTPATSQGHLRTPAQPPPASPAASSSSSFAAVVRYGPGAAAAAGTGGTGSDSASLELSAESRMILDAFAQQCSRVLSLLNCGGKLLDSNHSQSMISCVKQEGSSYNERQEHCHIGKGVHSQTSDNVDIEMQYMQRKQQTSAFLRVFTDSLQNYLLSGSFPTPNPSSASEYGHLADVDPLSTSPVHTLGGWTSPATSESHGHPSSSTLPEEEEEEDEEGYCPRCQELEQEVISLQQENEELRRKLESIPVPCQTVLDYLKMVLQHHNQLLIPQPADQPTEGSKQLLNNYPVYITSKQWDEAVNSSKKDGRRLLRYLIRFVFTTDELKYSCGLGKRKRSVQSGETGPERRPLDPVKVTCLRGTASFRSVSPSVISFHRIGCGSPRTSVQPSVF
Protein accession: AAI46594.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00389206-B01-13-15-1.jpg
Application image note: Western Blot analysis of BEND4 expression in transfected 293T cell line (H00389206-T01) by BEND4 MaxPab polyclonal antibody.

Lane 1: CCDC4 transfected lysate(45.76 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CCDC4 MaxPab mouse polyclonal antibody (B01) now

Add to cart