Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TMEM81 monoclonal antibody (M05), clone 3D5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about TMEM81 monoclonal antibody (M05), clone 3D5
| Brand: | Abnova |
| Reference: | H00388730-M05 |
| Product name: | TMEM81 monoclonal antibody (M05), clone 3D5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant TMEM81. |
| Clone: | 3D5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 388730 |
| Gene name: | TMEM81 |
| Gene alias: | HC3107|KVLA2788|MGC75217|UNQ2788 |
| Gene description: | transmembrane protein 81 |
| Genbank accession: | NM_203376.1 |
| Immunogen: | TMEM81 (NP_976310.1, 1 a.a. ~ 255 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKVLATSFVLGSLGLAFYLPLVVTTPKTLAIPEKLQEAVGKVIINATTCTVTCGLGYKEETVCEVGPDGVRRKCQTRRLECLTNWICGMLHFTILIGKEFELSCLSSDILEFGQEAFRFTWRLARGVISTDDEVFKPFQANSHFVKFKYAQEYDSGTYRCDVQLVKNLRLVKRLYFGLRVLPPNLVNLNFHQSLTEDQKLIDEGLEVNLDSYSKPHHPKWKKKVASALGIGIAIGVVGGVLVRIVLCALRGGLQQ |
| Protein accession: | NP_976310.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (54.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TMEM81 monoclonal antibody (M05), clone 3D5. Western Blot analysis of TMEM81 expression in human lung cancer. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |