Brand: | Abnova |
Reference: | H00388585-M01 |
Product name: | HES5 monoclonal antibody (M01), clone 3C5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HES5. |
Clone: | 3C5 |
Isotype: | IgG2b Kappa |
Gene id: | 388585 |
Gene name: | HES5 |
Gene alias: | bHLHb38 |
Gene description: | hairy and enhancer of split 5 (Drosophila) |
Genbank accession: | NM_001010926 |
Immunogen: | HES5 (NP_001010926, 28 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR |
Protein accession: | NP_001010926 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.34 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |