CCL4L2 monoclonal antibody (M01), clone 4G8 View larger

CCL4L2 monoclonal antibody (M01), clone 4G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCL4L2 monoclonal antibody (M01), clone 4G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CCL4L2 monoclonal antibody (M01), clone 4G8

Brand: Abnova
Reference: H00388372-M01
Product name: CCL4L2 monoclonal antibody (M01), clone 4G8
Product description: Mouse monoclonal antibody raised against a partial recombinant CCL4L2.
Clone: 4G8
Isotype: IgG2a Kappa
Gene id: 388372
Gene name: CCL4L2
Gene alias: AT744.2|CCL4L|SCYA4L
Gene description: chemokine (C-C motif) ligand 4-like 2
Genbank accession: NM_207007
Immunogen: CCL4L2 (NP_996890, 28 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
Protein accession: NP_996890
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00388372-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.26 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CCL4L2 monoclonal antibody (M01), clone 4G8 now

Add to cart