Brand: | Abnova |
Reference: | H00388372-M01 |
Product name: | CCL4L2 monoclonal antibody (M01), clone 4G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CCL4L2. |
Clone: | 4G8 |
Isotype: | IgG2a Kappa |
Gene id: | 388372 |
Gene name: | CCL4L2 |
Gene alias: | AT744.2|CCL4L|SCYA4L |
Gene description: | chemokine (C-C motif) ligand 4-like 2 |
Genbank accession: | NM_207007 |
Immunogen: | CCL4L2 (NP_996890, 28 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN |
Protein accession: | NP_996890 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.26 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |