Cart 6 Product Products 1 528,30 € (empty)
-
1 x Mouse...350,00 € -
1 x Olfactory...259,07 € -
1 x MMP-10...259,07 € -
1 x TRMT11...259,07 € -
-
1 x CCDC99...259,07 €
No products
To be determined Shipping
1 528,30 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 6 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 528,30 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 528,30 €
Data sheet of NANOGP8 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about NANOGP8 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00388112-B01P |
| Product name: | NANOGP8 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human NANOGP8 protein. |
| Gene id: | 388112 |
| Gene name: | NANOGP8 |
| Gene alias: | MGC119250|NANOG|NANOGP1 |
| Gene description: | Nanog homeobox pseudogene 8 |
| Genbank accession: | BC069807 |
| Immunogen: | NANOGP8 (AAH69807, 1 a.a. ~ 305 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMHFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV |
| Protein accession: | AAH69807 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NANOGP8 expression in transfected 293T cell line by NANOGP8 MaxPab polyclonal antibody. Lane 1: NANOGP8 transfected lysate(33.55 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |