Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00387758-B01P |
Product name: | FIBIN purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human FIBIN protein. |
Gene id: | 387758 |
Gene name: | FIBIN |
Gene alias: | MGC24932 |
Gene description: | fin bud initiation factor homolog (zebrafish) |
Genbank accession: | NM_203371.1 |
Immunogen: | FIBIN (NP_976249.1, 1 a.a. ~ 211 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MVFLKFFCMSFFCHLCQGYFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDHRRCSQGEGSQVGSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLALTIRSHGTRLGRLKNDYLKV |
Protein accession: | NP_976249.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FIBIN expression in transfected 293T cell line (H00387758-T01) by FIBIN MaxPab polyclonal antibody. Lane 1: FIBIN transfected lysate(23.21 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |