SUMO4 monoclonal antibody (M02), clone 1D3 View larger

SUMO4 monoclonal antibody (M02), clone 1D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SUMO4 monoclonal antibody (M02), clone 1D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SUMO4 monoclonal antibody (M02), clone 1D3

Brand: Abnova
Reference: H00387082-M02
Product name: SUMO4 monoclonal antibody (M02), clone 1D3
Product description: Mouse monoclonal antibody raised against a full-length recombinant SUMO4.
Clone: 1D3
Isotype: IgG2a Kappa
Gene id: 387082
Gene name: SUMO4
Gene alias: IDDM5|SMT3H4|SUMO-4|dJ281H8.4
Gene description: SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae)
Genbank accession: NM_001002255.1
Immunogen: SUMO4 (NP_001002255.1, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
Protein accession: NP_001002255.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00387082-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00387082-M02-13-15-1.jpg
Application image note: Western Blot analysis of SUMO4 expression in transfected 293T cell line by SUMO4 monoclonal antibody (M02), clone 1D3.

Lane 1: SUMO4 transfected lysate (Predicted MW: 10.7 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SUMO4 monoclonal antibody (M02), clone 1D3 now

Add to cart