Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00387082-M02 |
Product name: | SUMO4 monoclonal antibody (M02), clone 1D3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SUMO4. |
Clone: | 1D3 |
Isotype: | IgG2a Kappa |
Gene id: | 387082 |
Gene name: | SUMO4 |
Gene alias: | IDDM5|SMT3H4|SUMO-4|dJ281H8.4 |
Gene description: | SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae) |
Genbank accession: | NM_001002255.1 |
Immunogen: | SUMO4 (NP_001002255.1, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY |
Protein accession: | NP_001002255.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SUMO4 expression in transfected 293T cell line by SUMO4 monoclonal antibody (M02), clone 1D3. Lane 1: SUMO4 transfected lysate (Predicted MW: 10.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |