SUMO4 MaxPab mouse polyclonal antibody (B01) View larger

SUMO4 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SUMO4 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about SUMO4 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00387082-B01
Product name: SUMO4 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human SUMO4 protein.
Gene id: 387082
Gene name: SUMO4
Gene alias: IDDM5|SMT3H4|SUMO-4|dJ281H8.4
Gene description: SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae)
Genbank accession: NM_001002255.1
Immunogen: SUMO4 (NP_001002255.1, 1 a.a. ~ 95 a.a) full-length human protein.
Immunogen sequence/protein sequence: MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
Protein accession: NP_001002255.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00387082-B01-13-15-1.jpg
Application image note: Western Blot analysis of SUMO4 expression in transfected 293T cell line (H00387082-T01) by SUMO4 MaxPab polyclonal antibody.

Lane 1: SUMO4 transfected lysate(10.45 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SUMO4 MaxPab mouse polyclonal antibody (B01) now

Add to cart