KRTAP10-2 MaxPab mouse polyclonal antibody (B01) View larger

KRTAP10-2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KRTAP10-2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about KRTAP10-2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00386679-B01
Product name: KRTAP10-2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human KRTAP10-2 protein.
Gene id: 386679
Gene name: KRTAP10-2
Gene alias: KAP10.2|KAP18-2|KAP18.2|KRTAP10.2|KRTAP18-2|KRTAP18.2
Gene description: keratin associated protein 10-2
Genbank accession: BC146565
Immunogen: KRTAP10-2 (AAI46566.1, 1 a.a. ~ 255 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAASTMSICSSACTNSWQVDDCPESCCELPCGTPSCCAPAPCLTLVCTPVSCVSSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPVCCGASSCCQQSSCQPACCASSSCQQSCRVPVCCKAVCCVPTCSESSSSCCQQSSCQPACCTSSPCQQSCCVSVCCKPVCCKSICCVPVCSGASSPCCQQSSCQPACCTSSCCRPSSSVSLLCRPVCSRPASCSFSSGQKSSC
Protein accession: AAI46566.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00386679-B01-13-15-1.jpg
Application image note: Western Blot analysis of KRTAP10-2 expression in transfected 293T cell line (H00386679-T02) by KRTAP10-2 MaxPab polyclonal antibody.

Lane 1: KRTAP10-2 transfected lysate(28.05 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KRTAP10-2 MaxPab mouse polyclonal antibody (B01) now

Add to cart