Brand: | Abnova |
Reference: | H00386618-M04 |
Product name: | KCTD4 monoclonal antibody (M04), clone 2C8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant KCTD4. |
Clone: | 2C8 |
Isotype: | IgG2b Kappa |
Gene id: | 386618 |
Gene name: | KCTD4 |
Gene alias: | bA321C24.3 |
Gene description: | potassium channel tetramerisation domain containing 4 |
Genbank accession: | BC018063 |
Immunogen: | KCTD4 (AAH18063, 1 a.a. ~ 259 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIRFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK |
Protein accession: | AAH18063 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | KCTD4 monoclonal antibody (M04), clone 2C8 Western Blot analysis of KCTD4 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |