KCTD4 monoclonal antibody (M04), clone 2C8 View larger

KCTD4 monoclonal antibody (M04), clone 2C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KCTD4 monoclonal antibody (M04), clone 2C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA

More info about KCTD4 monoclonal antibody (M04), clone 2C8

Brand: Abnova
Reference: H00386618-M04
Product name: KCTD4 monoclonal antibody (M04), clone 2C8
Product description: Mouse monoclonal antibody raised against a full length recombinant KCTD4.
Clone: 2C8
Isotype: IgG2b Kappa
Gene id: 386618
Gene name: KCTD4
Gene alias: bA321C24.3
Gene description: potassium channel tetramerisation domain containing 4
Genbank accession: BC018063
Immunogen: KCTD4 (AAH18063, 1 a.a. ~ 259 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIRFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK
Protein accession: AAH18063
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00386618-M04-1-1-1.jpg
Application image note: KCTD4 monoclonal antibody (M04), clone 2C8 Western Blot analysis of KCTD4 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy KCTD4 monoclonal antibody (M04), clone 2C8 now

Add to cart