View larger

KCTD4 purified MaxPab rabbit polyclonal antibody (D01P)

Reference:

Condition: New product

Data sheet of KCTD4 purified MaxPab rabbit polyclonal antibody (D01P)

Brand:	Abnova
Reference:	H00386618-D01P
Product name:	KCTD4 purified MaxPab rabbit polyclonal antibody (D01P)
Product description:	Rabbit polyclonal antibody raised against a full-length human KCTD4 protein.
Gene id:	386618
Gene name:	KCTD4
Gene alias:	bA321C24.3
Gene description:	potassium channel tetramerisation domain containing 4
Genbank accession:	NM_198404.1
Immunogen:	KCTD4 (NP_940686.1, 1 a.a. ~ 259 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIRFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK
Protein accession:	NP_940686.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of KCTD4 expression in transfected 293T cell line (H00386618-T01) by KCTD4 MaxPab polyclonal antibody. Lane 1: KCTD4 transfected lysate(30.00 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice