Brand: | Abnova |
Reference: | H00378925-M09 |
Product name: | RNF148 monoclonal antibody (M09), clone 2D6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF148. |
Clone: | 2D6 |
Isotype: | IgG2a Kappa |
Gene id: | 378925 |
Gene name: | RNF148 |
Gene alias: | MGC35222 |
Gene description: | ring finger protein 148 |
Genbank accession: | NM_198085 |
Immunogen: | RNF148 (NP_932351.1, 139 a.a. ~ 238 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VFPMSHQGTENIVAVMISNLKGMEILHSIQKGVYVTVIIEVGRMHMQWVSHYIMYLFTFLAATIAYFYLDCVWRLTPRVPNSFTRRRSQIKTDVKKAIDQ |
Protein accession: | NP_932351.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |