RNF148 monoclonal antibody (M09), clone 2D6 View larger

RNF148 monoclonal antibody (M09), clone 2D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF148 monoclonal antibody (M09), clone 2D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about RNF148 monoclonal antibody (M09), clone 2D6

Brand: Abnova
Reference: H00378925-M09
Product name: RNF148 monoclonal antibody (M09), clone 2D6
Product description: Mouse monoclonal antibody raised against a partial recombinant RNF148.
Clone: 2D6
Isotype: IgG2a Kappa
Gene id: 378925
Gene name: RNF148
Gene alias: MGC35222
Gene description: ring finger protein 148
Genbank accession: NM_198085
Immunogen: RNF148 (NP_932351.1, 139 a.a. ~ 238 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VFPMSHQGTENIVAVMISNLKGMEILHSIQKGVYVTVIIEVGRMHMQWVSHYIMYLFTFLAATIAYFYLDCVWRLTPRVPNSFTRRRSQIKTDVKKAIDQ
Protein accession: NP_932351.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy RNF148 monoclonal antibody (M09), clone 2D6 now

Add to cart