RNF148 monoclonal antibody (M01), clone 2D3 View larger

RNF148 monoclonal antibody (M01), clone 2D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF148 monoclonal antibody (M01), clone 2D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RNF148 monoclonal antibody (M01), clone 2D3

Brand: Abnova
Reference: H00378925-M01
Product name: RNF148 monoclonal antibody (M01), clone 2D3
Product description: Mouse monoclonal antibody raised against a partial recombinant RNF148.
Clone: 2D3
Isotype: IgG2b Kappa
Gene id: 378925
Gene name: RNF148
Gene alias: MGC35222
Gene description: ring finger protein 148
Genbank accession: NM_198085
Immunogen: RNF148 (NP_932351.1, 139 a.a. ~ 238 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VFPMSHQGTENIVAVMISNLKGMEILHSIQKGVYVTVIIEVGRMHMQWVSHYIMYLFTFLAATIAYFYLDCVWRLTPRVPNSFTRRRSQIKTDVKKAIDQ
Protein accession: NP_932351.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00378925-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00378925-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged RNF148 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RNF148 monoclonal antibody (M01), clone 2D3 now

Add to cart