NHLRC1 monoclonal antibody (M01), clone 3G6 View larger

NHLRC1 monoclonal antibody (M01), clone 3G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NHLRC1 monoclonal antibody (M01), clone 3G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NHLRC1 monoclonal antibody (M01), clone 3G6

Brand: Abnova
Reference: H00378884-M01
Product name: NHLRC1 monoclonal antibody (M01), clone 3G6
Product description: Mouse monoclonal antibody raised against a partial recombinant NHLRC1.
Clone: 3G6
Isotype: IgG2a Kappa
Gene id: 378884
Gene name: NHLRC1
Gene alias: EPM2A|EPM2B|MALIN|MGC119262|MGC119264|MGC119265|bA204B7.2
Gene description: NHL repeat containing 1
Genbank accession: NM_198586
Immunogen: NHLRC1 (NP_940988.2, 137 a.a. ~ 246 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KTGRVVVVHDGRRRVKIFDSGGGCAHQFGEKGDAAQDIRYPVDVTITNDCHVVVTDAGDRSIKVFDFFGQIKLVIGGQFSLPWGVETTPQNGIVVTDAEAGSLHLLDVDF
Protein accession: NP_940988.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00378884-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00378884-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged NHLRC1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NHLRC1 monoclonal antibody (M01), clone 3G6 now

Add to cart