TRIM50C purified MaxPab mouse polyclonal antibody (B01P) View larger

TRIM50C purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIM50C purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about TRIM50C purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00378108-B01P
Product name: TRIM50C purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human TRIM50C protein.
Gene id: 378108
Gene name: TRIM74
Gene alias: MGC45440|TRIM50C
Gene description: tripartite motif-containing 74
Genbank accession: BC033871
Immunogen: TRIM50C (AAH33871, 1 a.a. ~ 249 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAWQVSLLELEDRLQCPICLEVFKESLMLQCGHSYCKGCLVSLSYHLDTKVRCPMCWQVVDGSSSLPNVSLAWVIEALRLPGDPEPKVCVHHRNPLSLFCEKDQELICGLCGLLGSHQHHPVTPVSTICSRMKEELAALFSELKQEQKKVDELIAKLVNNRTRIVNESDVFSWVIRREFQELRHPVDEEKARCLEGIGGHTRGLVASLDMQLEQAQGTRERLAQAECVLEQFGNEDHHEFIWFHSMASR
Protein accession: AAH33871
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00378108-B01P-13-15-1.jpg
Application image note: Western Blot analysis of TRIM50C expression in transfected 293T cell line by TRIM50C MaxPab polyclonal antibody.

Lane 1: TRIM50C transfected lysate(27.39 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TRIM50C purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart