DUB3 monoclonal antibody (M01), clone 3G12 View larger

DUB3 monoclonal antibody (M01), clone 3G12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUB3 monoclonal antibody (M01), clone 3G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about DUB3 monoclonal antibody (M01), clone 3G12

Brand: Abnova
Reference: H00377630-M01
Product name: DUB3 monoclonal antibody (M01), clone 3G12
Product description: Mouse monoclonal antibody raised against a partial recombinant DUB3.
Clone: 3G12
Isotype: IgG1 Kappa
Gene id: 377630
Gene name: DUB3
Gene alias: -
Gene description: deubiquitinating enzyme 3
Genbank accession: NM_201402
Immunogen: DUB3 (NP_958804, 431 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLVIHQSKYKCGMKNHHPEQQSSLLNLSSTTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ
Protein accession: NP_958804
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00377630-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00377630-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged DUB3 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DUB3 monoclonal antibody (M01), clone 3G12 now

Add to cart