SLC27A1 monoclonal antibody (M03), clone 2G9 View larger

SLC27A1 monoclonal antibody (M03), clone 2G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC27A1 monoclonal antibody (M03), clone 2G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about SLC27A1 monoclonal antibody (M03), clone 2G9

Brand: Abnova
Reference: H00376497-M03
Product name: SLC27A1 monoclonal antibody (M03), clone 2G9
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC27A1.
Clone: 2G9
Isotype: IgG2a Kappa
Gene id: 376497
Gene name: SLC27A1
Gene alias: ACSVL5|FATP|FATP1|FLJ00336|MGC71751
Gene description: solute carrier family 27 (fatty acid transporter), member 1
Genbank accession: NM_198580
Immunogen: SLC27A1 (NP_940982.1, 44 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LRIVCKTARRDLFGLSVLIRVRLELRRHQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEG
Protein accession: NP_940982.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00376497-M03-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC27A1 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SLC27A1 monoclonal antibody (M03), clone 2G9 now

Add to cart