Brand: | Abnova |
Reference: | H00376497-M03 |
Product name: | SLC27A1 monoclonal antibody (M03), clone 2G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC27A1. |
Clone: | 2G9 |
Isotype: | IgG2a Kappa |
Gene id: | 376497 |
Gene name: | SLC27A1 |
Gene alias: | ACSVL5|FATP|FATP1|FLJ00336|MGC71751 |
Gene description: | solute carrier family 27 (fatty acid transporter), member 1 |
Genbank accession: | NM_198580 |
Immunogen: | SLC27A1 (NP_940982.1, 44 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LRIVCKTARRDLFGLSVLIRVRLELRRHQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEG |
Protein accession: | NP_940982.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SLC27A1 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |