RAB15 monoclonal antibody (M01), clone 1G12 View larger

RAB15 monoclonal antibody (M01), clone 1G12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB15 monoclonal antibody (M01), clone 1G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about RAB15 monoclonal antibody (M01), clone 1G12

Brand: Abnova
Reference: H00376267-M01
Product name: RAB15 monoclonal antibody (M01), clone 1G12
Product description: Mouse monoclonal antibody raised against a partial recombinant RAB15.
Clone: 1G12
Isotype: IgG2a Kappa
Gene id: 376267
Gene name: RAB15
Gene alias: -
Gene description: RAB15, member RAS onocogene family
Genbank accession: BC040679
Immunogen: RAB15 (AAH40679, 99 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IMKWVSDVDEVGDATSLPGCGEGASPGKARRGPDGKANASRKLCLPQPWMKTSGTHQKASRRSLLGIRLMRSRNGRWEESKGSSWRRSMAWTSMKQVPAPTSTLKSHSRV
Protein accession: AAH40679
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00376267-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00376267-M01-13-15-1.jpg
Application image note: Western Blot analysis of RAB15 expression in transfected 293T cell line by RAB15 monoclonal antibody (M01), clone 1G12.

Lane 1: RAB15 transfected lysate(23.5 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RAB15 monoclonal antibody (M01), clone 1G12 now

Add to cart