C9orf169 monoclonal antibody (M09), clone 4E4 View larger

C9orf169 monoclonal antibody (M09), clone 4E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C9orf169 monoclonal antibody (M09), clone 4E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about C9orf169 monoclonal antibody (M09), clone 4E4

Brand: Abnova
Reference: H00375791-M09
Product name: C9orf169 monoclonal antibody (M09), clone 4E4
Product description: Mouse monoclonal antibody raised against a full-length recombinant C9orf169.
Clone: 4E4
Isotype: IgG2a Kappa
Gene id: 375791
Gene name: C9orf169
Gene alias: MGC59937
Gene description: chromosome 9 open reading frame 169
Genbank accession: NM_199001.1
Immunogen: C9orf169 (NP_945352.1, 1 a.a. ~ 144 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPVGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS
Protein accession: NP_945352.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00375791-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (41.7 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00375791-M09-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged C9orf169 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy C9orf169 monoclonal antibody (M09), clone 4E4 now

Add to cart