SLC26A5 monoclonal antibody (M04), clone 1F4 View larger

SLC26A5 monoclonal antibody (M04), clone 1F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC26A5 monoclonal antibody (M04), clone 1F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SLC26A5 monoclonal antibody (M04), clone 1F4

Brand: Abnova
Reference: H00375611-M04
Product name: SLC26A5 monoclonal antibody (M04), clone 1F4
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC26A5.
Clone: 1F4
Isotype: IgG2a Kappa
Gene id: 375611
Gene name: SLC26A5
Gene alias: DFNB61|MGC118886|MGC118887|MGC118888|MGC118889|PRES
Gene description: solute carrier family 26, member 5 (prestin)
Genbank accession: NM_198999
Immunogen: SLC26A5 (NP_945350, 645 a.a. ~ 741 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWELLFHSIHDAVLGSQLREALAEQEASAPPSQEDLEPNATPAT
Protein accession: NP_945350
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00375611-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00375611-M04-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC26A5 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC26A5 monoclonal antibody (M04), clone 1F4 now

Add to cart