MGC50811 MaxPab mouse polyclonal antibody (B01) View larger

MGC50811 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MGC50811 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MGC50811 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00375307-B01
Product name: MGC50811 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human MGC50811 protein.
Gene id: 375307
Gene name: C2orf62
Gene alias: MGC50811
Gene description: chromosome 2 open reading frame 62
Genbank accession: NM_198559.1
Immunogen: MGC50811 (NP_940961.1, 1 a.a. ~ 387 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSSKVYSTGSRAKDHQPSGPECLPLPEANAEAIDFLSSLHKEELQMLFFSETLAMVSDTGEPQGELTIEVQRGKYQEKLGMLTYCLFVHASSRGFLDKMLCGNSLLGYLSEKLELMEQHSQDFIKFLILPMERKMSLLKQDDQLAVTRSIKEGEEVKTGVTSFPWSSIKGFISEAANLVLLRVMAWRRMVPSNARFLTLDTEGKLCYLTYQNLGFQTIQVDHQQAEVFIVEQTVHAEEGIPMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDMELYSKFLDRKEELRLGHASYLRQHPEAHALISDFLLFLLLRQPEDVVTFAAEFFGPFDPWRPSSPALGSSHRPNPFRSLEPEGDARSGAA
Protein accession: NP_940961.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00375307-B01-13-15-1.jpg
Application image note: Western Blot analysis of C2orf62 expression in transfected 293T cell line (H00375307-T01) by C2orf62 MaxPab polyclonal antibody.

Lane 1: MGC50811 transfected lysate(42.57 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MGC50811 MaxPab mouse polyclonal antibody (B01) now

Add to cart