TMEM179B monoclonal antibody (M01), clone 3G8 View larger

TMEM179B monoclonal antibody (M01), clone 3G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMEM179B monoclonal antibody (M01), clone 3G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re

More info about TMEM179B monoclonal antibody (M01), clone 3G8

Brand: Abnova
Reference: H00374395-M01
Product name: TMEM179B monoclonal antibody (M01), clone 3G8
Product description: Mouse monoclonal antibody raised against a full-length recombinant TMEM179B.
Clone: 3G8
Isotype: IgG2a Kappa
Gene id: 374395
Gene name: TMEM179B
Gene alias: -
Gene description: transmembrane protein 179B
Genbank accession: NM_199337.1
Immunogen: TMEM179B (NP_955369.1, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MALSWLQRVELALFAAAFLCGAVAAAAMTRTQGSFSGRCPLYGVATLNGSSLALSRPSAPSLCYFVAGASGLLALYCLLLLLFWIYSSCIEDSHRGAIGLRIALAISAIAVFLVLVSACILRFGTRSLCNSIISLNTTISCSEAQKIPWTPPGTALQFYSNLHNAETSSWVNLVLWCVVLVLQVVQWKSEATPYRPLERGDPEWSSETDALVGSRLSHS
Protein accession: NP_955369.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00374395-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (50 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00374395-M01-2-A6-1.jpg
Application image note: TMEM179B monoclonal antibody (M01), clone 3G8. Western Blot analysis of TMEM179B expression in human lung cancer.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TMEM179B monoclonal antibody (M01), clone 3G8 now

Add to cart