GALNTL4 monoclonal antibody (M01A), clone 1F9 View larger

GALNTL4 monoclonal antibody (M01A), clone 1F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GALNTL4 monoclonal antibody (M01A), clone 1F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about GALNTL4 monoclonal antibody (M01A), clone 1F9

Brand: Abnova
Reference: H00374378-M01A
Product name: GALNTL4 monoclonal antibody (M01A), clone 1F9
Product description: Mouse monoclonal antibody raised against a partial recombinant GALNTL4.
Clone: 1F9
Isotype: IgG2b Kappa
Gene id: 374378
Gene name: GALNTL4
Gene alias: GALNT15|GALNT18|GalNAc-T15|MGC71806
Gene description: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 4
Genbank accession: NM_198516
Immunogen: GALNTL4 (NP_940918, 511 a.a. ~ 606 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SQQIHVGILSPTVDDDDNRCLVDVNSRPRLTECSYAKAKRMKLHWQFSQGGPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITNVLRSL*
Protein accession: NP_940918
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy GALNTL4 monoclonal antibody (M01A), clone 1F9 now

Add to cart