Brand: | Abnova |
Reference: | H00374378-M01 |
Product name: | GALNTL4 monoclonal antibody (M01), clone 1F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GALNTL4. |
Clone: | 1F9 |
Isotype: | IgG2b Kappa |
Gene id: | 374378 |
Gene name: | GALNTL4 |
Gene alias: | GALNT15|GALNT18|GalNAc-T15|MGC71806 |
Gene description: | UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 4 |
Genbank accession: | NM_198516 |
Immunogen: | GALNTL4 (NP_940918, 511 a.a. ~ 606 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SQQIHVGILSPTVDDDDNRCLVDVNSRPRLTECSYAKAKRMKLHWQFSQGGPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITNVLRSL* |
Protein accession: | NP_940918 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GALNTL4 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |