GALNTL4 monoclonal antibody (M01), clone 1F9 View larger

GALNTL4 monoclonal antibody (M01), clone 1F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GALNTL4 monoclonal antibody (M01), clone 1F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about GALNTL4 monoclonal antibody (M01), clone 1F9

Brand: Abnova
Reference: H00374378-M01
Product name: GALNTL4 monoclonal antibody (M01), clone 1F9
Product description: Mouse monoclonal antibody raised against a partial recombinant GALNTL4.
Clone: 1F9
Isotype: IgG2b Kappa
Gene id: 374378
Gene name: GALNTL4
Gene alias: GALNT15|GALNT18|GalNAc-T15|MGC71806
Gene description: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 4
Genbank accession: NM_198516
Immunogen: GALNTL4 (NP_940918, 511 a.a. ~ 606 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SQQIHVGILSPTVDDDDNRCLVDVNSRPRLTECSYAKAKRMKLHWQFSQGGPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITNVLRSL*
Protein accession: NP_940918
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00374378-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GALNTL4 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy GALNTL4 monoclonal antibody (M01), clone 1F9 now

Add to cart