NDUFS7 monoclonal antibody (M01), clone 3A3 View larger

NDUFS7 monoclonal antibody (M01), clone 3A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDUFS7 monoclonal antibody (M01), clone 3A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about NDUFS7 monoclonal antibody (M01), clone 3A3

Brand: Abnova
Reference: H00374291-M01
Product name: NDUFS7 monoclonal antibody (M01), clone 3A3
Product description: Mouse monoclonal antibody raised against a partial recombinant NDUFS7.
Clone: 3A3
Isotype: IgG2b Kappa
Gene id: 374291
Gene name: NDUFS7
Gene alias: CI-20KD|FLJ45860|FLJ46880|MGC120002|MY017|PSST
Gene description: NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase)
Genbank accession: NM_024407
Immunogen: NDUFS7 (NP_077718, 114 a.a. ~ 213 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR
Protein accession: NP_077718
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice
Publications: Mitochondrial complex I activity and oxidative damage to mitochondrial proteins in the prefrontal cortex of patients with bipolar disorder.Andreazza AC, Shao L, Wang JF, Young LT.
Arch Gen Psychiatry. 2010 Apr;67(4):360-8.

Reviews

Buy NDUFS7 monoclonal antibody (M01), clone 3A3 now

Add to cart