Brand: | Abnova |
Reference: | H00374291-M01 |
Product name: | NDUFS7 monoclonal antibody (M01), clone 3A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NDUFS7. |
Clone: | 3A3 |
Isotype: | IgG2b Kappa |
Gene id: | 374291 |
Gene name: | NDUFS7 |
Gene alias: | CI-20KD|FLJ45860|FLJ46880|MGC120002|MY017|PSST |
Gene description: | NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase) |
Genbank accession: | NM_024407 |
Immunogen: | NDUFS7 (NP_077718, 114 a.a. ~ 213 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR |
Protein accession: | NP_077718 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |
Publications: | Mitochondrial complex I activity and oxidative damage to mitochondrial proteins in the prefrontal cortex of patients with bipolar disorder.Andreazza AC, Shao L, Wang JF, Young LT. Arch Gen Psychiatry. 2010 Apr;67(4):360-8. |