Brand: | Abnova |
Reference: | H00373863-M16 |
Product name: | DND1 monoclonal antibody (M16), clone 2G9 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant DND1. |
Clone: | 2G9 |
Isotype: | IgG2b Kappa |
Gene id: | 373863 |
Gene name: | DND1 |
Gene alias: | MGC34750|RBMS4 |
Gene description: | dead end homolog 1 (zebrafish) |
Genbank accession: | NM_194249 |
Immunogen: | DND1 (NP_919225, 61 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FIGRLPQDVYEHQLIPLFQRVGRLYEFRLMMTFSGLNRGFAYARYSSRRGAQAAIATLHNHPLRPSCPLLVCRSTEKCELSVDGLPPNLTRS |
Protein accession: | NP_919225 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |