DND1 monoclonal antibody (M16), clone 2G9 View larger

DND1 monoclonal antibody (M16), clone 2G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DND1 monoclonal antibody (M16), clone 2G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about DND1 monoclonal antibody (M16), clone 2G9

Brand: Abnova
Reference: H00373863-M16
Product name: DND1 monoclonal antibody (M16), clone 2G9
Product description: Mouse monoclonal antibody raised against a full-length recombinant DND1.
Clone: 2G9
Isotype: IgG2b Kappa
Gene id: 373863
Gene name: DND1
Gene alias: MGC34750|RBMS4
Gene description: dead end homolog 1 (zebrafish)
Genbank accession: NM_194249
Immunogen: DND1 (NP_919225, 61 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FIGRLPQDVYEHQLIPLFQRVGRLYEFRLMMTFSGLNRGFAYARYSSRRGAQAAIATLHNHPLRPSCPLLVCRSTEKCELSVDGLPPNLTRS
Protein accession: NP_919225
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy DND1 monoclonal antibody (M16), clone 2G9 now

Add to cart