GSTK1 purified MaxPab mouse polyclonal antibody (B02P) View larger

GSTK1 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GSTK1 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about GSTK1 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00373156-B02P
Product name: GSTK1 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human GSTK1 protein.
Gene id: 373156
Gene name: GSTK1
Gene alias: GST|GST13|GST13-13|GSTK1-1
Gene description: glutathione S-transferase kappa 1
Genbank accession: NM_015917.1
Immunogen: GSTK1 (NP_057001.1, 1 a.a. ~ 226 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Protein accession: NP_057001.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00373156-B02P-13-15-1.jpg
Application image note: Western Blot analysis of GSTK1 expression in transfected 293T cell line (H00373156-T02) by GSTK1 MaxPab polyclonal antibody.

Lane 1: GSTK1 transfected lysate(24.86 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GSTK1 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart