ANKRD37 monoclonal antibody (M02), clone 6E8 View larger

ANKRD37 monoclonal antibody (M02), clone 6E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANKRD37 monoclonal antibody (M02), clone 6E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about ANKRD37 monoclonal antibody (M02), clone 6E8

Brand: Abnova
Reference: H00353322-M02
Product name: ANKRD37 monoclonal antibody (M02), clone 6E8
Product description: Mouse monoclonal antibody raised against a full-length recombinant ANKRD37.
Clone: 6E8
Isotype: IgG2a Kappa
Gene id: 353322
Gene name: ANKRD37
Gene alias: Lrp2bp|MGC111507
Gene description: ankyrin repeat domain 37
Genbank accession: NM_181726.1
Immunogen: ANKRD37 (NP_859077.1, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC
Protein accession: NP_859077.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00353322-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00353322-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ANKRD37 is 0.1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ANKRD37 monoclonal antibody (M02), clone 6E8 now

Add to cart