Brand: | Abnova |
Reference: | H00353322-M02 |
Product name: | ANKRD37 monoclonal antibody (M02), clone 6E8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant ANKRD37. |
Clone: | 6E8 |
Isotype: | IgG2a Kappa |
Gene id: | 353322 |
Gene name: | ANKRD37 |
Gene alias: | Lrp2bp|MGC111507 |
Gene description: | ankyrin repeat domain 37 |
Genbank accession: | NM_181726.1 |
Immunogen: | ANKRD37 (NP_859077.1, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC |
Protein accession: | NP_859077.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (43.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ANKRD37 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |