NUP43 monoclonal antibody (M03), clone 2G5 View larger

NUP43 monoclonal antibody (M03), clone 2G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUP43 monoclonal antibody (M03), clone 2G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr

More info about NUP43 monoclonal antibody (M03), clone 2G5

Brand: Abnova
Reference: H00348995-M03
Product name: NUP43 monoclonal antibody (M03), clone 2G5
Product description: Mouse monoclonal antibody raised against a partial recombinant NUP43.
Clone: 2G5
Isotype: IgG2a Kappa
Gene id: 348995
Gene name: NUP43
Gene alias: FLJ13287|bA350J20.1|p42
Gene description: nucleoporin 43kDa
Genbank accession: NM_024647
Immunogen: NUP43 (NP_078923.3, 281 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAIYVTRHLFS
Protein accession: NP_078923.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00348995-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00348995-M03-13-15-1.jpg
Application image note: Western Blot analysis of NUP43 expression in transfected 293T cell line by NUP43 monoclonal antibody (M03), clone 2G5.

Lane 1: NUP43 transfected lysate(42.2 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NUP43 monoclonal antibody (M03), clone 2G5 now

Add to cart