ZNF81 monoclonal antibody (M07), clone 3G3 View larger

ZNF81 monoclonal antibody (M07), clone 3G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF81 monoclonal antibody (M07), clone 3G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about ZNF81 monoclonal antibody (M07), clone 3G3

Brand: Abnova
Reference: H00347344-M07
Product name: ZNF81 monoclonal antibody (M07), clone 3G3
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF81.
Clone: 3G3
Isotype: IgG2b Kappa
Gene id: 347344
Gene name: ZNF81
Gene alias: FLJ44367|HFZ20|MRX45
Gene description: zinc finger protein 81
Genbank accession: NM_007137
Immunogen: ZNF81 (NP_009068.1, 1 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPANEDAPQPGEHGSACEVSVSFEDVTVDFSREEWQQLDSTQRRLYQDVMLENYSHLLSVGFEVPKPEVIFKLEQGEGPWTLEGEAPHQSCSDGKFGIKPSQRRISGKSTFHSEMEGEDTLC
Protein accession: NP_009068.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00347344-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.16 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00347344-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF81 is 0.3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF81 monoclonal antibody (M07), clone 3G3 now

Add to cart