Brand: | Abnova |
Reference: | H00347344-M07 |
Product name: | ZNF81 monoclonal antibody (M07), clone 3G3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF81. |
Clone: | 3G3 |
Isotype: | IgG2b Kappa |
Gene id: | 347344 |
Gene name: | ZNF81 |
Gene alias: | FLJ44367|HFZ20|MRX45 |
Gene description: | zinc finger protein 81 |
Genbank accession: | NM_007137 |
Immunogen: | ZNF81 (NP_009068.1, 1 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPANEDAPQPGEHGSACEVSVSFEDVTVDFSREEWQQLDSTQRRLYQDVMLENYSHLLSVGFEVPKPEVIFKLEQGEGPWTLEGEAPHQSCSDGKFGIKPSQRRISGKSTFHSEMEGEDTLC |
Protein accession: | NP_009068.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (39.16 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ZNF81 is 0.3 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |