MOGAT3 monoclonal antibody (M05), clone 3F7 View larger

MOGAT3 monoclonal antibody (M05), clone 3F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MOGAT3 monoclonal antibody (M05), clone 3F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about MOGAT3 monoclonal antibody (M05), clone 3F7

Brand: Abnova
Reference: H00346606-M05
Product name: MOGAT3 monoclonal antibody (M05), clone 3F7
Product description: Mouse monoclonal antibody raised against a partial recombinant MOGAT3.
Clone: 3F7
Isotype: IgG1 Kappa
Gene id: 346606
Gene name: MOGAT3
Gene alias: DC7|DGAT2L7|MGAT3|MGC119203|MGC119204
Gene description: monoacylglycerol O-acyltransferase 3
Genbank accession: NM_178176
Immunogen: MOGAT3 (NP_835470, 59 a.a. ~ 107 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDR
Protein accession: NP_835470
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00346606-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.13 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged MOGAT3 is approximately 10ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MOGAT3 monoclonal antibody (M05), clone 3F7 now

Add to cart