Brand: | Abnova |
Reference: | H00346007-Q01 |
Product name: | EYS (Human) Recombinant Protein (Q01) |
Product description: | Human EYS partial ORF ( XP_498111, 309 a.a. - 407 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 346007 |
Gene name: | EYS |
Gene alias: | C6orf178|C6orf179|C6orf180|EGFL10|EGFL11|KIAA0663|RP25|SPAM|bA166P24.2|bA307F22.3|bA74E24.1|dJ1018A4.2|dJ22I17.2|dJ303F19.1 |
Gene description: | eyes shut homolog (Drosophila) |
Genbank accession: | XM_498111 |
Immunogen sequence/protein sequence: | HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVT |
Protein accession: | XP_498111 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |