Brand: | Abnova |
Reference: | H00346007-M02 |
Product name: | EYS monoclonal antibody (M02), clone 3F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EYS. |
Clone: | 3F2 |
Isotype: | IgG2a Kappa |
Gene id: | 346007 |
Gene name: | EYS |
Gene alias: | C6orf178|C6orf179|C6orf180|EGFL10|EGFL11|KIAA0663|RP25|SPAM|bA166P24.2|bA307F22.3|bA74E24.1|dJ1018A4.2|dJ22I17.2|dJ303F19.1 |
Gene description: | eyes shut homolog (Drosophila) |
Genbank accession: | XM_498111 |
Immunogen: | EYS (XP_498111, 309 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVT |
Protein accession: | XP_498111 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged EYS is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |