Brand: | Abnova |
Reference: | H00345757-M08A |
Product name: | FAM174A monoclonal antibody (M08A), clone 1F3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant FAM174A. |
Clone: | 1F3 |
Isotype: | IgG2a Kappa |
Gene id: | 345757 |
Gene name: | FAM174A |
Gene alias: | MGC17345|TMEM157|UNQ1912 |
Gene description: | family with sequence similarity 174, member A |
Genbank accession: | NM_198507.1 |
Immunogen: | FAM174A (NP_940909.1, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKASQCCCCLSHLLASVLLLLLLPELSGPLAVLLQAAEAAPGLGPPDPRPRTLPPLPPGPTPAQQPGRGLAEAAGPRGSEGGNGSNPVAGLETDDHGGKAGEGSVGGGLAVSPNPGDKPMTQRALTVLMVVSGAVLVYFVVRTVRMRRRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR |
Protein accession: | NP_940909.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (46.4 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |