FAM174A monoclonal antibody (M08A), clone 1F3 View larger

FAM174A monoclonal antibody (M08A), clone 1F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAM174A monoclonal antibody (M08A), clone 1F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about FAM174A monoclonal antibody (M08A), clone 1F3

Brand: Abnova
Reference: H00345757-M08A
Product name: FAM174A monoclonal antibody (M08A), clone 1F3
Product description: Mouse monoclonal antibody raised against a full-length recombinant FAM174A.
Clone: 1F3
Isotype: IgG2a Kappa
Gene id: 345757
Gene name: FAM174A
Gene alias: MGC17345|TMEM157|UNQ1912
Gene description: family with sequence similarity 174, member A
Genbank accession: NM_198507.1
Immunogen: FAM174A (NP_940909.1, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKASQCCCCLSHLLASVLLLLLLPELSGPLAVLLQAAEAAPGLGPPDPRPRTLPPLPPGPTPAQQPGRGLAEAAGPRGSEGGNGSNPVAGLETDDHGGKAGEGSVGGGLAVSPNPGDKPMTQRALTVLMVVSGAVLVYFVVRTVRMRRRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR
Protein accession: NP_940909.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00345757-M08A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.4 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FAM174A monoclonal antibody (M08A), clone 1F3 now

Add to cart