Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00345193-M09 |
Product name: | LRIT3 monoclonal antibody (M09), clone 3E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LRIT3. |
Clone: | 3E7 |
Isotype: | IgG2a Kappa |
Gene id: | 345193 |
Gene name: | LRIT3 |
Gene alias: | FIGLER4|FLJ44691|MGC120618 |
Gene description: | leucine-rich repeat, immunoglobulin-like and transmembrane domains 3 |
Genbank accession: | NM_198506 |
Immunogen: | LRIT3 (NP_940908, 422 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTRSHRDDSEKLLLCSRSSVESQVTFKSEGSRPEYYC |
Protein accession: | NP_940908 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (33.99 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of LRIT3 expression in transfected 293T cell line by LRIT3 monoclonal antibody (M09), clone 3E7. Lane 1: LRIT3 transfected lysate(60.521 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |