LRIT3 monoclonal antibody (M09), clone 3E7 View larger

LRIT3 monoclonal antibody (M09), clone 3E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LRIT3 monoclonal antibody (M09), clone 3E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about LRIT3 monoclonal antibody (M09), clone 3E7

Brand: Abnova
Reference: H00345193-M09
Product name: LRIT3 monoclonal antibody (M09), clone 3E7
Product description: Mouse monoclonal antibody raised against a partial recombinant LRIT3.
Clone: 3E7
Isotype: IgG2a Kappa
Gene id: 345193
Gene name: LRIT3
Gene alias: FIGLER4|FLJ44691|MGC120618
Gene description: leucine-rich repeat, immunoglobulin-like and transmembrane domains 3
Genbank accession: NM_198506
Immunogen: LRIT3 (NP_940908, 422 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTRSHRDDSEKLLLCSRSSVESQVTFKSEGSRPEYYC
Protein accession: NP_940908
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00345193-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00345193-M09-13-15-1.jpg
Application image note: Western Blot analysis of LRIT3 expression in transfected 293T cell line by LRIT3 monoclonal antibody (M09), clone 3E7.

Lane 1: LRIT3 transfected lysate(60.521 KDa).
Lane 2: Non-transfected lysate.
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LRIT3 monoclonal antibody (M09), clone 3E7 now

Add to cart