Brand: | Abnova |
Reference: | H00344387-M03 |
Product name: | CDKL4 monoclonal antibody (M03), clone 6G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDKL4. |
Clone: | 6G8 |
Isotype: | IgG1 Kappa |
Gene id: | 344387 |
Gene name: | CDKL4 |
Gene alias: | - |
Gene description: | cyclin-dependent kinase-like 4 |
Genbank accession: | NM_001009565 |
Immunogen: | CDKL4 (AAV63975, 196 a.a. ~ 295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPVALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQIK |
Protein accession: | AAV63975 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to CDKL4 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |