CDKL4 monoclonal antibody (M03), clone 6G8 View larger

CDKL4 monoclonal antibody (M03), clone 6G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDKL4 monoclonal antibody (M03), clone 6G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about CDKL4 monoclonal antibody (M03), clone 6G8

Brand: Abnova
Reference: H00344387-M03
Product name: CDKL4 monoclonal antibody (M03), clone 6G8
Product description: Mouse monoclonal antibody raised against a partial recombinant CDKL4.
Clone: 6G8
Isotype: IgG1 Kappa
Gene id: 344387
Gene name: CDKL4
Gene alias: -
Gene description: cyclin-dependent kinase-like 4
Genbank accession: NM_001009565
Immunogen: CDKL4 (AAV63975, 196 a.a. ~ 295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPVALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQIK
Protein accession: AAV63975
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00344387-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00344387-M03-3-10-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CDKL4 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CDKL4 monoclonal antibody (M03), clone 6G8 now

Add to cart