NANOS3 monoclonal antibody (M02), clone 4B11 View larger

NANOS3 monoclonal antibody (M02), clone 4B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NANOS3 monoclonal antibody (M02), clone 4B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NANOS3 monoclonal antibody (M02), clone 4B11

Brand: Abnova
Reference: H00342977-M02
Product name: NANOS3 monoclonal antibody (M02), clone 4B11
Product description: Mouse monoclonal antibody raised against a partial recombinant NANOS3.
Clone: 4B11
Isotype: IgG2b Kappa
Gene id: 342977
Gene name: NANOS3
Gene alias: MGC120114|NANOS1L|NOS3
Gene description: nanos homolog 3 (Drosophila)
Genbank accession: XM_292819
Immunogen: NANOS3 (XP_292819.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAG
Protein accession: XP_292819.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00342977-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00342977-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged NANOS3 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NANOS3 monoclonal antibody (M02), clone 4B11 now

Add to cart