HKR2 (Human) Recombinant Protein (Q01) View larger

HKR2 (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HKR2 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about HKR2 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00342945-Q01
Product name: HKR2 (Human) Recombinant Protein (Q01)
Product description: Human HKR2 partial ORF ( NP_862829.1, 196 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 342945
Gene name: ZSCAN22
Gene alias: HKR2|MGC126679|MGC138482|ZNF50
Gene description: zinc finger and SCAN domain containing 22
Genbank accession: NM_181846
Immunogen sequence/protein sequence: KSVTQQIHFKKTSGPYKDVPTDQRGRESGASRNSSSAWPNLTSQEKPPSEDKFDLVDAYGTEPPYTYSGKRSSKCRECRKMFQSASALEAHQKTHSRKT
Protein accession: NP_862829.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00342945-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HKR2 (Human) Recombinant Protein (Q01) now

Add to cart