ZSCAN22 monoclonal antibody (M08), clone 3E9 View larger

ZSCAN22 monoclonal antibody (M08), clone 3E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZSCAN22 monoclonal antibody (M08), clone 3E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ZSCAN22 monoclonal antibody (M08), clone 3E9

Brand: Abnova
Reference: H00342945-M08
Product name: ZSCAN22 monoclonal antibody (M08), clone 3E9
Product description: Mouse monoclonal antibody raised against a partial recombinant ZSCAN22.
Clone: 3E9
Isotype: IgG2a Kappa
Gene id: 342945
Gene name: ZSCAN22
Gene alias: HKR2|MGC126679|MGC138482|ZNF50
Gene description: zinc finger and SCAN domain containing 22
Genbank accession: NM_181846
Immunogen: ZSCAN22 (NP_862829.1, 196 a.a. ~ 294 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KSVTQQIHFKKTSGPYKDVPTDQRGRESGASRNSSSAWPNLTSQEKPPSEDKFDLVDAYGTEPPYTYSGKRSSKCRECRKMFQSASALEAHQKTHSRKT
Protein accession: NP_862829.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00342945-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00342945-M08-1-12-1.jpg
Application image note: ZSCAN22 monoclonal antibody (M08), clone 3E9. Western Blot analysis of ZSCAN22 expression in HepG2.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZSCAN22 monoclonal antibody (M08), clone 3E9 now

Add to cart