Brand: | Abnova |
Reference: | H00342945-M08 |
Product name: | ZSCAN22 monoclonal antibody (M08), clone 3E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZSCAN22. |
Clone: | 3E9 |
Isotype: | IgG2a Kappa |
Gene id: | 342945 |
Gene name: | ZSCAN22 |
Gene alias: | HKR2|MGC126679|MGC138482|ZNF50 |
Gene description: | zinc finger and SCAN domain containing 22 |
Genbank accession: | NM_181846 |
Immunogen: | ZSCAN22 (NP_862829.1, 196 a.a. ~ 294 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KSVTQQIHFKKTSGPYKDVPTDQRGRESGASRNSSSAWPNLTSQEKPPSEDKFDLVDAYGTEPPYTYSGKRSSKCRECRKMFQSASALEAHQKTHSRKT |
Protein accession: | NP_862829.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ZSCAN22 monoclonal antibody (M08), clone 3E9. Western Blot analysis of ZSCAN22 expression in HepG2. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |