NACAL monoclonal antibody (M01), clone 4H6 View larger

NACAL monoclonal antibody (M01), clone 4H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NACAL monoclonal antibody (M01), clone 4H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about NACAL monoclonal antibody (M01), clone 4H6

Brand: Abnova
Reference: H00342538-M01
Product name: NACAL monoclonal antibody (M01), clone 4H6
Product description: Mouse monoclonal antibody raised against a partial recombinant NACAL.
Clone: 4H6
Isotype: IgG2a Kappa
Gene id: 342538
Gene name: NACA2
Gene alias: ANAC|MGC71999|NACAL
Gene description: nascent polypeptide-associated complex alpha subunit 2
Genbank accession: NM_199290
Immunogen: NACAL (NP_954984, 116 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ASDAYIVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
Protein accession: NP_954984
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00342538-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00342538-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged NACA2 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NACAL monoclonal antibody (M01), clone 4H6 now

Add to cart