Brand: | Abnova |
Reference: | H00342538-M01 |
Product name: | NACAL monoclonal antibody (M01), clone 4H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NACAL. |
Clone: | 4H6 |
Isotype: | IgG2a Kappa |
Gene id: | 342538 |
Gene name: | NACA2 |
Gene alias: | ANAC|MGC71999|NACAL |
Gene description: | nascent polypeptide-associated complex alpha subunit 2 |
Genbank accession: | NM_199290 |
Immunogen: | NACAL (NP_954984, 116 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ASDAYIVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV |
Protein accession: | NP_954984 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NACA2 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |