Brand: | Abnova |
Reference: | H00342184-M07 |
Product name: | FMN1 monoclonal antibody (M07), clone 4F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FMN1. |
Clone: | 4F4 |
Isotype: | IgG2a Kappa |
Gene id: | 342184 |
Gene name: | FMN1 |
Gene alias: | DKFZp686C2281|DKFZp686G2387|FLJ45135|FMN|LD|MGC125288|MGC125289 |
Gene description: | formin 1 |
Genbank accession: | XM_375185 |
Immunogen: | FMN1 (XP_375185.1, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MENVDNSLDGSDVSEPAKPEAGLEVAQSILSKFSMKSLFGFTSKLESVNPEEEDAVLKAFHSLDVNPTSQQDDSSNGLDPQEAGSRVSPDLGNDEKIASVETESEGSQR |
Protein accession: | XP_375185.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FMN1 monoclonal antibody (M07), clone 4F4. Western Blot analysis of FMN1 expression in Jurkat. |
Applications: | WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |