FMN1 monoclonal antibody (M07), clone 4F4 View larger

FMN1 monoclonal antibody (M07), clone 4F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FMN1 monoclonal antibody (M07), clone 4F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re

More info about FMN1 monoclonal antibody (M07), clone 4F4

Brand: Abnova
Reference: H00342184-M07
Product name: FMN1 monoclonal antibody (M07), clone 4F4
Product description: Mouse monoclonal antibody raised against a partial recombinant FMN1.
Clone: 4F4
Isotype: IgG2a Kappa
Gene id: 342184
Gene name: FMN1
Gene alias: DKFZp686C2281|DKFZp686G2387|FLJ45135|FMN|LD|MGC125288|MGC125289
Gene description: formin 1
Genbank accession: XM_375185
Immunogen: FMN1 (XP_375185.1, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MENVDNSLDGSDVSEPAKPEAGLEVAQSILSKFSMKSLFGFTSKLESVNPEEEDAVLKAFHSLDVNPTSQQDDSSNGLDPQEAGSRVSPDLGNDEKIASVETESEGSQR
Protein accession: XP_375185.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00342184-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00342184-M07-1-6-1.jpg
Application image note: FMN1 monoclonal antibody (M07), clone 4F4. Western Blot analysis of FMN1 expression in Jurkat.
Applications: WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FMN1 monoclonal antibody (M07), clone 4F4 now

Add to cart