AKR1CL1 monoclonal antibody (M04), clone 4G8 View larger

AKR1CL1 monoclonal antibody (M04), clone 4G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AKR1CL1 monoclonal antibody (M04), clone 4G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about AKR1CL1 monoclonal antibody (M04), clone 4G8

Brand: Abnova
Reference: H00340811-M04
Product name: AKR1CL1 monoclonal antibody (M04), clone 4G8
Product description: Mouse monoclonal antibody raised against a full-length recombinant AKR1CL1.
Clone: 4G8
Isotype: IgG2a Kappa
Gene id: 340811
Gene name: AKR1CL1
Gene alias: FLJ16347
Gene description: aldo-keto reductase family 1, member C-like 1
Genbank accession: NM_001007536.1
Immunogen: AKR1CL1 (NP_001007537.1, 1 a.a. ~ 129 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MMTDLKQSHSVRLNDGPFMPVLGFGTYAPDHTPKSQAAEATKVAIDVGFRHIDSAYLYQNEEEVGQAIWEKIADGTVKREEIFYTIKLWATFFRAELVHPALERSLKKLGPDYVDLFIIHVPFAMKGSS
Protein accession: NP_001007537.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00340811-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00340811-M04-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged AKR1CL1 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AKR1CL1 monoclonal antibody (M04), clone 4G8 now

Add to cart