Brand: | Abnova |
Reference: | H00340811-M04 |
Product name: | AKR1CL1 monoclonal antibody (M04), clone 4G8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant AKR1CL1. |
Clone: | 4G8 |
Isotype: | IgG2a Kappa |
Gene id: | 340811 |
Gene name: | AKR1CL1 |
Gene alias: | FLJ16347 |
Gene description: | aldo-keto reductase family 1, member C-like 1 |
Genbank accession: | NM_001007536.1 |
Immunogen: | AKR1CL1 (NP_001007537.1, 1 a.a. ~ 129 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MMTDLKQSHSVRLNDGPFMPVLGFGTYAPDHTPKSQAAEATKVAIDVGFRHIDSAYLYQNEEEVGQAIWEKIADGTVKREEIFYTIKLWATFFRAELVHPALERSLKKLGPDYVDLFIIHVPFAMKGSS |
Protein accession: | NP_001007537.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged AKR1CL1 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |