NANOS1 monoclonal antibody (M01), clone 5F12 View larger

NANOS1 monoclonal antibody (M01), clone 5F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NANOS1 monoclonal antibody (M01), clone 5F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NANOS1 monoclonal antibody (M01), clone 5F12

Brand: Abnova
Reference: H00340719-M01
Product name: NANOS1 monoclonal antibody (M01), clone 5F12
Product description: Mouse monoclonal antibody raised against a partial recombinant NANOS1.
Clone: 5F12
Isotype: IgG1 Kappa
Gene id: 340719
Gene name: NANOS1
Gene alias: NOS1
Gene description: nanos homolog 1 (Drosophila)
Genbank accession: NM_199461.2
Immunogen: NANOS1 (NP_955631.1, 206 a.a. ~ 270 a.a) partial recombinant protein with GST-pstS1 tag.
Immunogen sequence/protein sequence: LLKPELQVCVFCRNNKEAMALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSKV
Protein accession: NP_955631.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00340719-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.09 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00340719-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged NANOS1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NANOS1 monoclonal antibody (M01), clone 5F12 now

Add to cart