Brand: | Abnova |
Reference: | H00340719-M01 |
Product name: | NANOS1 monoclonal antibody (M01), clone 5F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NANOS1. |
Clone: | 5F12 |
Isotype: | IgG1 Kappa |
Gene id: | 340719 |
Gene name: | NANOS1 |
Gene alias: | NOS1 |
Gene description: | nanos homolog 1 (Drosophila) |
Genbank accession: | NM_199461.2 |
Immunogen: | NANOS1 (NP_955631.1, 206 a.a. ~ 270 a.a) partial recombinant protein with GST-pstS1 tag. |
Immunogen sequence/protein sequence: | LLKPELQVCVFCRNNKEAMALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSKV |
Protein accession: | NP_955631.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.09 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NANOS1 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |