Brand: | Abnova |
Reference: | H00340561-M01 |
Product name: | MGC42638 monoclonal antibody (M01), clone 2F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MGC42638. |
Clone: | 2F7 |
Isotype: | IgG2a Kappa |
Gene id: | 340561 |
Gene name: | UBE2DNL |
Gene alias: | MGC42638 |
Gene description: | ubiquitin-conjugating enzyme E2D N-terminal like pseudogene |
Genbank accession: | BC040290 |
Immunogen: | MGC42638 (AAH40290, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MALKLIHKEFLELARDPQPHCSAGPVWDDMLHWQATITRPNDSSYLGGVFFLKFPSDYLFKPPKIKFTNGIYHQR |
Protein accession: | AAH40290 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MGC42638 monoclonal antibody (M01), clone 2F7. Western Blot analysis of MGC42638 expression in IMR-32. |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |