MGC42638 monoclonal antibody (M01), clone 2F7 View larger

MGC42638 monoclonal antibody (M01), clone 2F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MGC42638 monoclonal antibody (M01), clone 2F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA

More info about MGC42638 monoclonal antibody (M01), clone 2F7

Brand: Abnova
Reference: H00340561-M01
Product name: MGC42638 monoclonal antibody (M01), clone 2F7
Product description: Mouse monoclonal antibody raised against a partial recombinant MGC42638.
Clone: 2F7
Isotype: IgG2a Kappa
Gene id: 340561
Gene name: UBE2DNL
Gene alias: MGC42638
Gene description: ubiquitin-conjugating enzyme E2D N-terminal like pseudogene
Genbank accession: BC040290
Immunogen: MGC42638 (AAH40290, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MALKLIHKEFLELARDPQPHCSAGPVWDDMLHWQATITRPNDSSYLGGVFFLKFPSDYLFKPPKIKFTNGIYHQR
Protein accession: AAH40290
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00340561-M01-1-19-1.jpg
Application image note: MGC42638 monoclonal antibody (M01), clone 2F7. Western Blot analysis of MGC42638 expression in IMR-32.
Applications: WB-Ce,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy MGC42638 monoclonal antibody (M01), clone 2F7 now

Add to cart