ANKRD45 MaxPab mouse polyclonal antibody (B01) View larger

ANKRD45 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANKRD45 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ANKRD45 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00339416-B01
Product name: ANKRD45 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human ANKRD45 protein.
Gene id: 339416
Gene name: ANKRD45
Gene alias: FLJ45235|MGC161631|MGC161633|RP3-436N22.4
Gene description: ankyrin repeat domain 45
Genbank accession: NM_198493
Immunogen: ANKRD45 (NP_940895, 1 a.a. ~ 266 a.a) full-length human protein.
Immunogen sequence/protein sequence: MESEGPPESESSEFFSQQEEENEEEEAQEPEETGPKNPLLQPALTGDVEGLQKIFEDPENPHHEQAMQLLLEEDIVGRNLLYAACMAGQSDVIRALAKYGVNLNEKTTRGYTLLHCAAAWGRLETLKALVELDVDIEALNFREERARDVAARYSQTECVEFLDWADARLTLKKYIAKVSLAVTDTEKGSGKLLKEDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDIVTPIFTKMTTPCQVKSAKSVTSHDQKRSQDDTSN
Protein accession: NP_940895
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00339416-B01-13-15-1.jpg
Application image note: Western Blot analysis of ANKRD45 expression in transfected 293T cell line (H00339416-T01) by ANKRD45 MaxPab polyclonal antibody.

Lane 1: ANKRD45 transfected lysate(29.26 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ANKRD45 MaxPab mouse polyclonal antibody (B01) now

Add to cart