Cart 41 Product Products 13 770,68 € (empty)
No products
To be determined Shipping
13 770,68 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 41 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 13 770,68 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 13 770,68 €
Data sheet of NANOS2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about NANOS2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00339345-B01P |
| Product name: | NANOS2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human NANOS2 protein. |
| Gene id: | 339345 |
| Gene name: | NANOS2 |
| Gene alias: | NOS2 |
| Gene description: | nanos homolog 2 (Drosophila) |
| Genbank accession: | NM_001029861 |
| Immunogen: | NANOS2 (NP_001025032, 1 a.a. ~ 138 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR |
| Protein accession: | NP_001025032 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NANOS2 expression in transfected 293T cell line (H00339345-T01) by NANOS2 MaxPab polyclonal antibody. Lane 1: NANOS2 transfected lysate(15.18 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Opposing effects of retinoic acid and FGF9 on Nanos2 expression and meiotic entry of mouse germ cells.Barrios F, Filipponi D, Pellegrini M, Paronetto MP, Di Siena S, Geremia R, Rossi P, De Felici M, Jannini EA, Dolci S. J Cell Sci. 2010 Mar 15;123(Pt 6):871-80. Epub 2010 Feb 16. |