Brand: | Abnova |
Reference: | H00339318-M01 |
Product name: | ZNF181 monoclonal antibody (M01), clone 5F1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF181. |
Clone: | 5F1 |
Isotype: | IgG2a Kappa |
Gene id: | 339318 |
Gene name: | ZNF181 |
Gene alias: | HHZ181|MGC44316 |
Gene description: | zinc finger protein 181 |
Genbank accession: | XM_290835 |
Immunogen: | ZNF181 (XP_290835, 354 a.a. ~ 461 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FIHRSSLIHHQKIHTGEKPYECRECGKAFCCSSHLTRHQRIHTMEKQYECNKCLKVFSSLSFLVQHQSIHTEEKPFECQKCRKSFNQLESLNMHLRNHIRLKPYECSI |
Protein accession: | XP_290835 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ZNF181 monoclonal antibody (M01), clone 5F1 Western Blot analysis of ZNF181 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,IF,ELISA |
Shipping condition: | Dry Ice |