ZNF181 monoclonal antibody (M01), clone 5F1 View larger

ZNF181 monoclonal antibody (M01), clone 5F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF181 monoclonal antibody (M01), clone 5F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA

More info about ZNF181 monoclonal antibody (M01), clone 5F1

Brand: Abnova
Reference: H00339318-M01
Product name: ZNF181 monoclonal antibody (M01), clone 5F1
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF181.
Clone: 5F1
Isotype: IgG2a Kappa
Gene id: 339318
Gene name: ZNF181
Gene alias: HHZ181|MGC44316
Gene description: zinc finger protein 181
Genbank accession: XM_290835
Immunogen: ZNF181 (XP_290835, 354 a.a. ~ 461 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FIHRSSLIHHQKIHTGEKPYECRECGKAFCCSSHLTRHQRIHTMEKQYECNKCLKVFSSLSFLVQHQSIHTEEKPFECQKCRKSFNQLESLNMHLRNHIRLKPYECSI
Protein accession: XP_290835
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00339318-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00339318-M01-1-4-1.jpg
Application image note: ZNF181 monoclonal antibody (M01), clone 5F1 Western Blot analysis of ZNF181 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,IF,ELISA
Shipping condition: Dry Ice

Reviews

Buy ZNF181 monoclonal antibody (M01), clone 5F1 now

Add to cart