RAB43 monoclonal antibody (M09), clone 4C11 View larger

RAB43 monoclonal antibody (M09), clone 4C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB43 monoclonal antibody (M09), clone 4C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RAB43 monoclonal antibody (M09), clone 4C11

Brand: Abnova
Reference: H00339122-M09
Product name: RAB43 monoclonal antibody (M09), clone 4C11
Product description: Mouse monoclonal antibody raised against a partial recombinant RAB43.
Clone: 4C11
Isotype: IgG2a Kappa
Gene id: 339122
Gene name: RAB43
Gene alias: ISY1|MGC90481|RAB11B|RAB41
Gene description: RAB43, member RAS oncogene family
Genbank accession: NM_198490
Immunogen: RAB43 (NP_940892, 113 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGC
Protein accession: NP_940892
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00339122-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00339122-M09-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged RAB43 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RAB43 monoclonal antibody (M09), clone 4C11 now

Add to cart